PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA36G00036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 217aa    MW: 25923.3 Da    PI: 7.1984
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA36G00036genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.6e-181158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEde+lv+ v++lG ++W++ ar  g++R++k+c++rw +yl
       AA36G00036 11 RGPWLEEEDEKLVKFVTLLGERRWDSLARVSGLKRSGKSCRLRWMNYL 58
                     89********************************************97 PP

2Myb_DNA-binding51.42.4e-1665108247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+ +++E+++++++++++G++ W++Iar+++ gRt++++k++w+++
       AA36G00036  65 GPISKDEELIIIQLHALWGNK-WAKIARRLP-GRTDNEIKNYWRTH 108
                      67799****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.238658IPR017930Myb domain
SMARTSM007173.7E-141060IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-2710105IPR009057Homeodomain-like
PfamPF002491.2E-141158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-201265IPR009057Homeodomain-like
CDDcd001673.47E-91358No hitNo description
PROSITE profilePS5129426.01559113IPR017930Myb domain
SMARTSM007175.5E-1663111IPR001005SANT/Myb domain
PfamPF002495.4E-1565108IPR001005SANT/Myb domain
CDDcd001675.45E-1066109No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MDYVKKEFVR RGPWLEEEDE KLVKFVTLLG ERRWDSLARV SGLKRSGKSC RLRWMNYLHP  60
SLKHGPISKD EELIIIQLHA LWGNKWAKIA RRLPGRTDNE IKNYWRTHFR KKEQPQIYGE  120
ISMTRKTHEH VLKKNQTSLE DDQERYVGIF ERESLCVLNS PYENRILDWI SEISTDQSEA  180
NLVEDHSCSN NEQNIDIGSW WLQETRDFVE FSSTLWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-26111124104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293114.11e-106hypothetical protein CARUB_v10019409mg
SwissprotQ53NK64e-52MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLR0FT621e-106R0FT62_9BRAS; Uncharacterized protein
STRINGBra006977.1-P1e-102(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.11e-105myb domain protein 27